PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_209.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 197aa    MW: 22613.7 Da    PI: 8.7014
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_209.3genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26088.31e-271987169
                       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69
                                 +Ca+Ck++r+kC++dC+lapyfp +++++f++vhk+FG+snv+kl+++l+ +++++a++slv+eA +r+
  evm.model.supercontig_209.3 19 PCASCKHQRKKCNNDCILAPYFPIDKNREFQVVHKVFGVSNVQKLIRNLKGDDQKKAVESLVWEASCRQ 87
                                 7*****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.34318119IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-271989IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MQGDNENNSS NTIGGTHPPC ASCKHQRKKC NNDCILAPYF PIDKNREFQV VHKVFGVSNV  60
QKLIRNLKGD DQKKAVESLV WEASCRQKIQ YKELMENTKE SMMQLPGQGA TMFKLGMPMM  120
GWNGNHEMIN NNNNNNMLNF NQENNKLIFD SNTYYYPSTN IEKLKNDHVG VTVTPQIQQQ  180
QQMQYPINQF YLPGKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-18988180LOB family transfactor Ramosa2.1
5ly0_B2e-18988180LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_209.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018824188.19e-49PREDICTED: LOB domain-containing protein 2-like
SwissprotQ9LNB91e-30LBD2_ARATH; LOB domain-containing protein 2
TrEMBLA0A2I4EXR82e-47A0A2I4EXR8_JUGRE; LOB domain-containing protein 2-like
STRINGevm.model.supercontig_209.31e-145(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-31LOB domain-containing protein 2