PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_208.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family G2-like
Protein Properties Length: 359aa    MW: 40093.4 Da    PI: 9.1193
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_208.13genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-32193246255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  evm.model.supercontig_208.13 193 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 246
                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.76E-15190246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28191246IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23193246IPR006447Myb domain, plants
PfamPF002492.3E-7194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNTK PSSTWPRRSS TEEDMDLGFW KRALESRSSI SSMAKPDNSC  60
FDLSLSNPRV ISDSNSSHFH LQFPQSGTNC HGNNFFHSLH QNRLQTHQLF HQHQHPQGLS  120
QELGFLRPIR GIPVYQNSPP HPPPFSFPQH SLDSSPSSLA GTSTTYQHQS TSQGLMRSRF  180
VSRFPTKRSM RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH  240
LQMYRTVKTT DRAAASSGQS DAYENGSSGD NSDDLVFDIQ ARQGGHQDKD YHALWSNSSR  300
EAWLHAKPKD STPNMPSIED AKCINYERLS SSDVSSSSQS AGTSPKKPNL EFTLGRPH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2430933e-34AC243093.1 Gossypioides kirkii clone GKH065D10-jlt, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040692.11e-158Homeodomain-like superfamily protein isoform 1
RefseqXP_007040693.11e-158Homeodomain-like superfamily protein isoform 1
SwissprotQ9C6161e-101KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A061G7401e-158A0A061G740_THECC; Homeodomain-like superfamily protein isoform 1
STRINGPOPTR_0001s02010.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.16e-73G2-like family protein