PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_20.86
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 172aa    MW: 19077.2 Da    PI: 11.7747
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_20.86genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.92.4e-221760245
                                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                 +i  ks rqvtfskRr+g++KKA+EL++LC+ae+a+++fs+  k
  evm.model.supercontig_20.86 17 KIAKKSHRQVTFSKRRAGLFKKASELCTLCGAEIAIVVFSPACK 60
                                 68899***********************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554559.94E-27881IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.207868IPR002100Transcription factor, MADS-box
SMARTSM004328.8E-31867IPR002100Transcription factor, MADS-box
CDDcd002657.12E-32978No hitNo description
PRINTSPR004049.5E-181030IPR002100Transcription factor, MADS-box
PfamPF003194.3E-241764IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MAKKTASMGR QRIPIAKIAK KSHRQVTFSK RRAGLFKKAS ELCTLCGAEI AIVVFSPACK  60
AFSFGHPEVE SIVDRFLTKN PPPNQPTNAA HQLVEAHRNA NRRKRGEKSL SLRRMLAGDI  120
AGGRIRWKNL RLNQLQQLKN ALEELKKNVG RQLTGFWFSL QSFGVDGNGG Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-18896187MEF2C
5f28_B3e-18896187MEF2C
5f28_C3e-18896187MEF2C
5f28_D3e-18896187MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_20.86
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021903843.17e-98LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL61
SwissprotQ4PSU46e-41AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLA0A1S2YWY34e-55A0A1S2YWY3_CICAR; agamous-like MADS-box protein AGL61
STRINGevm.model.supercontig_20.861e-123(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-38AGAMOUS-like 61
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]