PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_20.85
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 243aa    MW: 27292.6 Da    PI: 4.6972
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_20.85genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.63.2e-232874349
                                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                                  +nk  rqvtfskRr+g++KKA+EL+vLC+ae+a+i fs+++k +++
  evm.model.supercontig_20.85 28 LQNKNARQVTFSKRRTGLFKKASELCVLCGAEIAIIAFSPNDKPFTF 74
                                 689***************************************98888 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.5951878IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-321877IPR002100Transcription factor, MADS-box
CDDcd002651.32E-351987No hitNo description
SuperFamilySSF554555.23E-291991IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-202040IPR002100Transcription factor, MADS-box
PfamPF003194.3E-252974IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-204055IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-205576IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MKKIISNNNN NNKIKTSKGR QKIEIKELQN KNARQVTFSK RRTGLFKKAS ELCVLCGAEI  60
AIIAFSPNDK PFTFGHPNVD SIVDRYLADN NHTDDDYNQS EGQEISETMT LDPSLQELNR  120
EYEEAMEELK EEKKRAKKIE EVKKESGEGF WWDESVDGLE LDELEEYVKA LEELRKKVIN  180
RGKELVMMED MAVAGIGSST DVVVDHQQMS TGCGSSSVID DGCSNNGGFH GFSFGFGDIM  240
KF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A9e-151990172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_B9e-151990172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_C9e-151990172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_D9e-151990172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
3kov_A1e-141986168Myocyte-specific enhancer factor 2A
3kov_B1e-141986168Myocyte-specific enhancer factor 2A
3kov_I1e-141986168Myocyte-specific enhancer factor 2A
3kov_J1e-141986168Myocyte-specific enhancer factor 2A
3p57_A1e-141986168Myocyte-specific enhancer factor 2A
3p57_B1e-141986168Myocyte-specific enhancer factor 2A
3p57_C1e-141986168Myocyte-specific enhancer factor 2A
3p57_D1e-141986168Myocyte-specific enhancer factor 2A
3p57_I1e-141986168Myocyte-specific enhancer factor 2A
3p57_J1e-141986168Myocyte-specific enhancer factor 2A
5f28_A1e-141986269MEF2C
5f28_B1e-141986269MEF2C
5f28_C1e-141986269MEF2C
5f28_D1e-141986269MEF2C
6byy_C1e-141986269MEF2 CHIMERA
6byy_D1e-141986269MEF2 CHIMERA
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_20.85
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021903842.11e-180agamous-like MADS-box protein AGL61
TrEMBLA0A2R6RC511e-58A0A2R6RC51_ACTCH; Agamous-like MADS-box protein
STRINGevm.model.supercontig_20.851e-179(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15814714
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-37AGAMOUS-like 61