PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_2.327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 259aa    MW: 28111.8 Da    PI: 8.0019
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_2.327genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.66.8e-41541541101
                       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82 
                                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe +r da++slvyeA+ r+rdPvyG++g i +
  evm.model.supercontig_2.327  54 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLMEVPECQRADAANSLVYEANLRLRDPVYGCMGAICA 135
                                  7********************************************************************************* PP

                       DUF260  83 lqqqleqlkaelallkeel 101
                                  lqqq++ l+ael+++++e+
  evm.model.supercontig_2.327 136 LQQQIQALQAELNAVRNEI 154
                                  **************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.91753154IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-4154151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MSRDREIFVD EIGKKIKREI STVVTGPADA YNSDQMGRRH VALSPPGIFN TITPCAACKL  60
LRRRCAEECP FSPYFSPHEP HKFAAVHKVF GASNVSKMLM EVPECQRADA ANSLVYEANL  120
RLRDPVYGCM GAICALQQQI QALQAELNAV RNEILKYKYG SDHQATNTNM IINPNSTHHA  180
ALINPNSVAA ISQNNTLPNL NPPRCSPPPP PPLPPPPSIV ISSSSSTTTA SSMYNQQPSS  240
SGGYSSISSD QNNVPYFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-425416111118LOB family transfactor Ramosa2.1
5ly0_B3e-425416111118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_2.327
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021909979.10.0LOB domain-containing protein 15
SwissprotQ8L5T57e-75LBD15_ARATH; LOB domain-containing protein 15
SwissprotQ9AT611e-74LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A2P5AHJ88e-91A0A2P5AHJ8_TREOI; Wilm's tumor protein
STRINGevm.model.supercontig_2.3270.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-75LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]
  2. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]