PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_2.298
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 404aa    MW: 43000.1 Da    PI: 7.0049
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_2.298genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.38.9e-10205261561
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                                  kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +     l s
  evm.model.supercontig_2.298 205 KRAKRILANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLTLFQRDTTGLSS 261
                                  9****************************************9998877666655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-15201265IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611203266IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.09E-10205256No hitNo description
PfamPF001701.2E-8205262IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-8205260No hitNo description
CDDcd147039.72E-24206255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MSMEIQDPEF KPKPNPNSSP NISPLPNAAT SSFSSGPTSL LHAPALLRGG PHHRRAHSEV  60
SFRMPDDMSM MMTDLSPPPG PISGGGAAAA GGGGGSSTAS FEEIGSEDDV FSTYIDVDKL  120
AGGSIGSGDC AAGRNCTDHT AAAGGGGDKM PTSSTSNTTS LSRPRHRHSN SMDGGSSMYG  180
GAEIMEAKKA MPPDKLAELW NLDPKRAKRI LANRQSAARS KERKARYILE LERKVQTLQT  240
EATTLSAQLT LFQRDTTGLS SENTELKLRL QAMEQQAQLR DALNEALKKE VERLKIATGE  300
MMSPSESFNL GMHHMQYVPS AFLPIPQQLG PASHPNMQLP PFSHSQASMP SHHLHHANSH  360
HISELLQNDP LGRLQGLDIG SKGSSLMKSE GPSLSASESS STY*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_2.298
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2296784e-43KP229678.1 UNVERIFIED: Boehmeria nivea Basic leucine zipper transcription factor-like (bZIP12) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021909692.10.0transcription factor RF2b-like
SwissprotQ6S4P41e-105RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A061GYW11e-175A0A061GYW1_THECC; Basic-leucine zipper transcription factor family protein
STRINGevm.model.supercontig_2.2980.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.14e-94bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]