PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_2.240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 601aa    MW: 65377 Da    PI: 5.8854
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_2.240genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS443.11.9e-1352435911374
                         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                  lv++L++cAeav+ ++l+la+al++++  la +++ +m+++a+yf+eALa+r++r    ly    p++  +++ s+ l++  
  evm.model.supercontig_2.240 243 LVHALMACAEAVQRNNLNLAEALVKQIGFLAISQAGAMRKVATYFAEALARRIYR----LY----PQNPLDHSLSDILQM-- 314
                                  689****************************************************....44....454444446666555.. PP

                         GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetger 164
                                   f+e++P+lkf+h+taNqaIlea+eg++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p++++++ l+e+g++
  evm.model.supercontig_2.240 315 HFYETCPYLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPTQDNSDHLQEVGWK 396
                                  5********************************************************************************* PP

                         GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe 245
                                  La++Ae+++v+fe++ +va++l+dl+ ++L+++p +E++aVn+v++lh+ll++++++e+    vL++vk+++P++v++veqe
  evm.model.supercontig_2.240 397 LAQLAETIHVQFEYRGFVANSLADLDASMLELRPgEESVAVNSVFELHKLLARPGAIEK----VLSVVKQMKPEIVTIVEQE 474
                                  **********************************889**********************....******************* PP

                         GRAS 246 adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                                  a+hn++ Fl+rf+e+l+yys+lfdsle +             ++lg++i+nvvaceg +r+erhetl++Wr+rl++aGF pv
  evm.model.supercontig_2.240 475 ASHNGPVFLDRFTESLHYYSTLFDSLEGS-------------VYLGKQICNVVACEGVDRTERHETLAQWRSRLGSAGFAPV 543
                                  *****************************.............69************************************** PP

                         GRAS 328 plsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                  +l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  evm.model.supercontig_2.240 544 HLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLGWHTRPLIATSAWK 591
                                  ***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011296.1E-3750123No hitNo description
PfamPF120417.7E-3450117IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098562.409217570IPR005202Transcription factor GRAS
PfamPF035146.7E-133243591IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MKRDHHHLHL HPHTHPHPHP QPDPSSSSCL AGKSTMWGSG DEPPDDGGMD ELLAVLGYKV  60
RTSDMADVAQ KLEQLEEMMG SVQVDGLSHL ATDTVHYNPS ELSSFLESML TELNPPSTSA  120
LDPMLSVPSI DDSFLAPAES STITSIDFGA PPCNPSRVFD ESSSSDYDLK VIPGKALCSQ  180
TQAHLDSLSS NQGSSNKRLK PSSAAPTSEA FSSSSMPSFG IPATAESTRP VVLVDSQENG  240
IRLVHALMAC AEAVQRNNLN LAEALVKQIG FLAISQAGAM RKVATYFAEA LARRIYRLYP  300
QNPLDHSLSD ILQMHFYETC PYLKFAHFTA NQAILEAFEG KKRVHVIDFS MNQGMQWPAL  360
MQALALRPGG PPAFRLTGIG PPTQDNSDHL QEVGWKLAQL AETIHVQFEY RGFVANSLAD  420
LDASMLELRP GEESVAVNSV FELHKLLARP GAIEKVLSVV KQMKPEIVTI VEQEASHNGP  480
VFLDRFTESL HYYSTLFDSL EGSVYLGKQI CNVVACEGVD RTERHETLAQ WRSRLGSAGF  540
APVHLGSNAF KQASMLLALF AGGDGYRVEE NNGCLMLGWH TRPLIATSAW KLGGKPVVGN  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-502435914375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007045197.10.0GRAS family transcription factor family protein
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A061EFF90.0A0A061EFF9_THECC; GRAS family transcription factor family protein
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein