PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_2.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 126aa    MW: 14165.4 Da    PI: 10.5861
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_2.20genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.56.6e-17740134
                        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                                C++Cg+ +TplWR gp  ++ LCnaCG +yr++g
  evm.model.supercontig_2.20  7 CRHCGVESTPLWRDGPLEKPVLCNACGSRYRLRG 40
                                ****************99999**********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.5E-8153IPR000679Zinc finger, GATA-type
CDDcd002028.31E-13640No hitNo description
SuperFamilySSF577162.76E-12656No hitNo description
PfamPF003201.9E-14740IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.464740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.8E-13741IPR013088Zinc finger, NHR/GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MMRKGPCRHC GVESTPLWRD GPLEKPVLCN ACGSRYRLRG AESLINYVPK QVQLNLTKMK  60
RKPKKSYRNT KKVKPSPQQV VVKTEPIEID DNSFYVNPPS LPQLNPATKQ ISNQITTNFQ  120
PSQTG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_2.20
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGevm.model.supercontig_2.208e-88(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1890268
Representative plantOGRP27491530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.12e-20GATA transcription factor 27