PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_195.45
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family TALE
Protein Properties Length: 689aa    MW: 76363 Da    PI: 6.5141
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_195.45genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.5e-093944311954
                                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                   Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  evm.model.supercontig_195.45 394 FEHflHPYPKDSDKIVLAKQTGLTRSQVSNWFINARVR 431
                                   554459******************************88 PP

2BELL111.54.6e-36249320172
                          BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                   erqel++kk+kLl++le++++rYkqy++q+qtv+s Fe++agl+sak+Yt l l++iS+ FrcLkdai+ q+
  evm.model.supercontig_195.45 249 ERQELKMKKTKLLNMLEQIEERYKQYQQQMQTVVSCFEQIAGLDSAKSYTGLGLQTISKRFRCLKDAISVQV 320
                                   79*******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.3E-47173318IPR006563POX domain
PfamPF075262.4E-42180317IPR006563POX domain
PROSITE profilePS5007112.001372435IPR001356Homeobox domain
SMARTSM003891.2E-9375439IPR001356Homeobox domain
CDDcd000866.74E-12375436No hitNo description
Gene3DG3DSA:1.10.10.602.8E-28378442IPR009057Homeodomain-like
SuperFamilySSF466891.24E-16379442IPR009057Homeodomain-like
PfamPF059201.0E-17392431IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MATYFHGSSE IQPANDGLQT LYLVNPTYLP YSSVPSFNAA GNSLTLTNIP HAPPSSHPHL  60
TSIHLPTSPP VMGPTNSDDP LRSSGLHAVS LYNLCVGVDQ NSGQITVPTG GGHDEFYRRF  120
YPPVVSPTWQ GLSLSLSSEQ VSTYRSSSSN VDMQGQSSSS TTASFPAVSN GFSGVHGVAL  180
GSKFLRAAQE LLDEVVNVGK IIKFDQPITN GMIKEKMKES TAGEVAGSGS EAIGNGHHYK  240
PASELTTAER QELKMKKTKL LNMLEQIEER YKQYQQQMQT VVSCFEQIAG LDSAKSYTGL  300
GLQTISKRFR CLKDAISVQV KATSKSLEDE EDWLSGATTT SFKVEAGYSK LRYIDHQLRQ  360
QRALQQIGVV RNNAWRSQRG LPERAVSVLR AWLFEHFLHP YPKDSDKIVL AKQTGLTRSQ  420
VSNWFINARV RLWKPMVEEM YMEEIKEKKP KNLDDEDQKN STNNHHEHKK YEYSLPSPQN  480
QIYNDIVEES KQEIKNQFSS NSTMSRSLHQ HQTSFINLVG SSDYRVEPAR INSTKAADND  540
DNQIRSSTTK KQRILSHELQ NSPSRKIVLS SGIEMKQIIT SGNGGMNLSK FGDGDDDDDD  600
NDDDDDDDQN LINGSGGFGG YINLMDQQLS TPRLIHGKSN GISLTLGPPP HCESISLSGN  660
LNSFPSNQLH IRRLELGNGD DQPDFCWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B4e-16381438158Homeobox protein Meis1
4xrs_A4e-16381438158Homeobox protein Meis1
3k2a_B4e-16381439563Homeobox protein Meis2
3k2a_A4e-16381439563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485172.11e-165PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012485171.11e-165PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0D2Q7Y91e-165A0A0D2Q7Y9_G
STRINGVIT_06s0009g00410.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.33e-83BEL1-like homeodomain 1