PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_195.42
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family FAR1
Protein Properties Length: 258aa    MW: 29356 Da    PI: 6.4077
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_195.42genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR191.11.5e-2898185291
                          FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkle 82 
                                   fYn+YA++vGF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkw+vtk++
  evm.model.supercontig_195.42  98 FYNAYATQVGFIIRVSKLSRSRRDGSAIGRALVCNKEGYRMPDKRE--KIVRQRAETRVGCRAMILVRKVSSGKWVVTKFV 176
                                   ******************************************9988..9******************************** PP

                          FAR1  83 leHnHelap 91 
                                   +eH+H+l+p
  evm.model.supercontig_195.42 177 KEHTHPLTP 185
                                   ******986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.7E-2698185IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MADNYICFVF YVEFGIESDI NGEIIKNTIE IESNRVGDDN LTGGNSLQVT FQQDEDFKLD  60
QDSSQGSIPQ AMPAVSVVPA DEPYVGQEFE SEVAAHAFYN AYATQVGFII RVSKLSRSRR  120
DGSAIGRALV CNKEGYRMPD KREKIVRQRA ETRVGCRAMI LVRKVSSGKW VVTKFVKEHT  180
HPLTPGKGRR DCIYDQYPNE HDKIRELSQQ LAVERKRAAT YKRHLELIFE QIEEHNESLS  240
KKIQHIVDSV REIENSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097543.11e-151hypothetical protein L484_024756
TrEMBLW9RTC01e-151W9RTC0_9R
STRINGGLYMA15G03440.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73022539
Representative plantOGRP10299610
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-114FAR1 family protein