PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_192.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 172aa    MW: 18599.2 Da    PI: 8.1357
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_192.6genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.67e-46131121100
                       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82 
                                  +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++
  evm.model.supercontig_192.6  13 PCAACKLLRRRCAQDCVFAPYFPADEPHKFANVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISS 94 
                                  7********************************************************************************* PP

                       DUF260  83 lqqqleqlkaelallkee 100
                                  lq+q++ l+++lal+++e
  evm.model.supercontig_192.6  95 LQHQIDILQTQLALAQAE 112
                                  *************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.14412113IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKESGRKQGA ASPCAACKLL RRRCAQDCVF APYFPADEPH KFANVHKVFG ASNVNKMLQE  60
LPEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQHQID ILQTQLALAQ AEVVQLRLRQ  120
TASFSAHGLS PTSPSSSGSP SSRFITSQPK PIFDMDMGMD QASLGEPMWS C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-5091157113LOB family transfactor Ramosa2.1
5ly0_B4e-5091157113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_192.6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021887577.11e-126LOB domain-containing protein 4
SwissprotQ9SHE92e-80LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0D2UNR81e-105A0A0D2UNR8_GOSRA; Uncharacterized protein
TrEMBLA0A2P5Q7G31e-105A0A2P5Q7G3_GOSBA; Uncharacterized protein
STRINGevm.model.supercontig_192.61e-125(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-82LOB domain-containing protein 4