PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_192.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 168aa    MW: 19155 Da    PI: 10.1074
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_192.10genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.72e-1026621450
                                  HHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                        SRF-TF 14 skRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                   +R+ +i  KAe   +LCd+ v++i ++++g+l +++
  evm.model.supercontig_192.10 26 VNRKRTIKVKAEQRGTLCDVPVCLIGYGPDGELITWP 62
                                  59**********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.92E-102597IPR002100Transcription factor, MADS-box
PfamPF003191.7E-52761IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MLQGSPPSRL YQTISPLHQQ QQCKKVNRKR TIKVKAEQRG TLCDVPVCLI GYGPDGELIT  60
WPENRPEVKE LVPKYKKSTS NSEKRNEYDL ESFLKTKKKT LGQDNGRIAG DRWPTSDKRL  120
DGLGNFDLVD LMVQLDSKLQ SLTQRRDHLI KSTAVPLNFM FAKPDRE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18397KRNEYDLESFLKTKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_192.10
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021887586.11e-113agamous-like MADS-box protein AGL103
STRINGevm.model.supercontig_192.101e-121(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Representative plantOGRP1213926
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02235.16e-16AGAMOUS-like 51