PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_19.151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 178aa    MW: 19865.6 Da    PI: 8.6877
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_19.151genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.43.9e-41141131100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+l+r+C+++C++apyf +++pkkfa vhk+FGasnv+k+l ++pee+red+++sl+yeAear+rdPvyG++g i 
  evm.model.supercontig_19.151  14 SCAACKFLKRRCSPNCIFAPYFRSDEPKKFAKVHKVFGASNVSKILIEVPEEQREDTVNSLAYEAEARLRDPVYGCIGAIA 94 
                                   6******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq+++ +l+++la ++++
  evm.model.supercontig_19.151  95 LLQRKMVELQHDLAIARAR 113
                                   *************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6913114IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4014111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MKAMRGHEPR SSSSCAACKF LKRRCSPNCI FAPYFRSDEP KKFAKVHKVF GASNVSKILI  60
EVPEEQREDT VNSLAYEAEA RLRDPVYGCI GAIALLQRKM VELQHDLAIA RARLARYSAN  120
PSSSSSYISV FNNHMAMPSF NDLPGYGGLL FDGYGQSYSL EINRDGQMYD FSQTPYV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-4891186115LOB family transfactor Ramosa2.1
5ly0_B9e-4891186115LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_19.151
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021904125.11e-130LOB domain-containing protein 21
SwissprotQ9SRL82e-71LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A438J2F21e-93A0A438J2F2_VITVI; LOB domain-containing protein 21
STRINGevm.model.supercontig_19.1511e-130(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.11e-70LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]