PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_19.133
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 177aa    MW: 19766.4 Da    PI: 6.9448
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_19.133genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601444.4e-4561051100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +Ca+Ck+lrr+C+kdC++apyfpa++p+kfa+vhk+FGasnv+k+l++lp e+r da+sslvyeA+ar+rdPvyG+vg i+
  evm.model.supercontig_19.133   6 PCASCKLLRRRCVKDCIFAPYFPADDPHKFAIVHKVFGASNVSKMLQELPVEQRGDAVSSLVYEANARMRDPVYGCVGAIS 86 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq+q++ql+ +la++++e
  evm.model.supercontig_19.133  87 YLQNQVSQLQMQLAVAQAE 105
                                   ***************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9275106IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCVKD CIFAPYFPAD DPHKFAIVHK VFGASNVSKM LQELPVEQRG  60
DAVSSLVYEA NARMRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MHQDPINTIT  120
QTPSQIDHDH RDDKSFLLDH HHHHHQYYNF ASPAGNVVIQ DSLKRESLFG VHDLVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4721077112LOB family transfactor Ramosa2.1
5ly0_B1e-4721077112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_19.133
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021903937.11e-130LOB domain-containing protein 12-like
SwissprotQ8LBW31e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1R3FW322e-92A0A1R3FW32_COCAP; Uncharacterized protein
STRINGevm.model.supercontig_19.1331e-129(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-75LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]