PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_188.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 333aa    MW: 35387.5 Da    PI: 9.0247
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_188.14genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-3979138362
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  evm.model.supercontig_188.14  79 ETALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 138
                                   7789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3462131IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3281136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60982136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MVFTSIPAYL DPVNWQQQQV ANHQAGGTSG AGIHLLPPPP PPPPLPPAVP QPHGEGGAGS  60
IRPGSMADRA RLANIPMPET ALKCPRCEST NTKFCYFNNY SLSQPRHFCK TCRRYWTRGG  120
ALRNVPVGGG CRRNKRSKGS NSSKSSSAVS GDRPTGSGST ASMSCNSNEM IGLGTPLPQL  180
RFMAPLHHLT GHDDLGLSYG PVSAPLVGGT SELVPGTSLL LDQWRLQQFP LLGGFDSSYG  240
LYPFEASSYG GGAGQIRPKL STTGMATQLA SVKMEDSNNN NNSNQQEMNL SRQFLGVNPA  300
AGYDHIHHYW NNAATSWSDV SSFSSSSTSN PL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Binds to 5'-TAAAGT-3' motif in REV promoter to triggers its transcription, thus regulating adaxial-abaxial polarity and influencing leaf axial patterning in an auxin transport- and response-dependent manner (e.g. IAA6 and IAA19 genes expression) (PubMed:20807212). Probably involved in early processes for vascular development (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:17583520, ECO:0000269|PubMed:20807212, ECO:0000269|PubMed:30626969}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_188.14
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin in procambium. {ECO:0000269|PubMed:30626969}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021887727.10.0dof zinc finger protein DOF5.1-like
SwissprotQ9LZ562e-57DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLA0A061ET141e-118A0A061ET14_THECC; DNA binding with one finger 2.4, putative
STRINGevm.model.supercontig_188.140.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.15e-49DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]