PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_18.54
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 442aa    MW: 49844.2 Da    PI: 6.8033
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_18.54genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS142.25.2e-441904071214
                         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetsekn...ssee 77 
                                  lv+lLl++Ae    +++e+a++lL+  + +asp+g++++ ++++f+eAL++r+ + ++  ++k+l +++ +++++     ++
  evm.model.supercontig_18.54 190 LVHLLLAAAEKAGYQQFERASKLLSYCELTASPNGNAVELIVFCFAEALRERIEKeTGRVTAKKLdRAKGKNKSDhglNLNT 271
                                  68*****************************************************555555666644444444344443333 PP

                         GRAS  78 laalkl...fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgsk 155
                                   +   +   +++  P+l+ +h++  q++l+ v +  ++H iD++i  G+QW  L+qaL +++  +   l+iT+v+ ++  s+
  evm.model.supercontig_18.54 272 SS---TfarLYQRLPFLQATHFAGVQTLLDNVGSPGKLHLIDLQIRTGVQWTVLMQALVEQEkYPIELLKITAVAVES--SR 348
                                  33...24559*************************************************998456669********66..** PP

                         GRAS 156 eeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll 214
                                  e++eetg rL+  A+++++pf+f+++++ ++++++ + ++++ +Ea+aV + l l ++ 
  evm.model.supercontig_18.54 349 EKIEETGLRLKTTAKSMNLPFSFHAVYVPDMTEIKESLFKIEDDEAIAVYCPLILRTME 407
                                  ****************************************************9888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098525.262164441IPR005202Transcription factor GRAS
PfamPF035141.8E-41190407IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MASGFFSYTS SDLRATQTTS HSLKDYREKE HVIGVEPLEN FHSFSWESGN VFQENIPNKP  60
QFLDLAEHDQ SSQHQTRSNP FKPGEFQQLE TDEHRAESVN KMTHPSGLSS LELLNSYGNG  120
LRRLKSNQFQ IVSAKQRSTQ KQSTEEIIRA ASARYVQFSD LRYDDFSIMM HPFGYALSGF  180
SKEEMKDVEL VHLLLAAAEK AGYQQFERAS KLLSYCELTA SPNGNAVELI VFCFAEALRE  240
RIEKETGRVT AKKLDRAKGK NKSDHGLNLN TSSTFARLYQ RLPFLQATHF AGVQTLLDNV  300
GSPGKLHLID LQIRTGVQWT VLMQALVEQE KYPIELLKIT AVAVESSREK IEETGLRLKT  360
TAKSMNLPFS FHAVYVPDMT EIKESLFKIE DDEAIAVYCP LILRTMETRL LGESDEGDKK  420
SQPINHGGHR SGSESQLARV R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-1419641614220GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051112.11e-114GRAS family transcription factor, putative
TrEMBLA0A061DR511e-114A0A061DR51_THECC; GRAS family transcription factor, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07520.13e-18GRAS family protein