PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_18.252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family BES1
Protein Properties Length: 761aa    MW: 85438.9 Da    PI: 6.2153
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_18.252genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822148.74.8e-46772191136
                        DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl.. 76 
                                   gg++r ++ +E+E++k+RER+RRai+a+i+aGLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   ++skp   
  evm.model.supercontig_18.252  77 GGNRRCRPLEEKERTKLRERHRRAITARILAGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsrsQSSKPVgg 157
                                   578999***************************************************************987788888884 PP

                        DUF822  77 .eeaeaagssasaspesslq.sslkssalaspvesysaspksssfpspssldsislasaasl 136
                                    ++  +  ss+ as++++   ++ +ss  +s +e  s+++k + +p ps +d  ++a ++++
  evm.model.supercontig_18.252 158 tSAGMTSSSSHMASQQTPPPvLRGVSSGYRSSMEYNSCRMKGVFVPTPSPYDLSPVARSQTS 219
                                   333344444555899999998999****************************9999865443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.5E-3979214IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514452.81E-180259703IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.805.2E-199262700IPR013781Glycoside hydrolase, catalytic domain
PfamPF013732.3E-101268688IPR001554Glycoside hydrolase, family 14
PRINTSPR007506.3E-69299313IPR001554Glycoside hydrolase, family 14
PRINTSPR007506.3E-69320338IPR001554Glycoside hydrolase, family 14
PRINTSPR007506.3E-69342363IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060346354IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR008427.7E-7425434IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007506.3E-69435457IPR001554Glycoside hydrolase, family 14
PRINTSPR007506.3E-69508527IPR001554Glycoside hydrolase, family 14
PRINTSPR007506.3E-69542558IPR001554Glycoside hydrolase, family 14
PRINTSPR007506.3E-69559570IPR001554Glycoside hydrolase, family 14
PRINTSPR007506.3E-69577600IPR001554Glycoside hydrolase, family 14
PRINTSPR008427.7E-7580590IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007506.3E-69617639IPR001554Glycoside hydrolase, family 14
PRINTSPR008427.7E-7668682IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008427.7E-7683697IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 761 aa     Download sequence    Send to blast
MATDMQKLIG TGEEDDDEDV EMDVKEEDDE DEENREKHIA TQVMVGVDGG MPPSGSSNQF  60
QHHQQIQEQV STPGGGGGNR RCRPLEEKER TKLRERHRRA ITARILAGLR RHGNYNLRVR  120
ADINDVIAAL AREAGWVVLP DGTTFPSRSQ SSKPVGGTSA GMTSSSSHMA SQQTPPPVLR  180
GVSSGYRSSM EYNSCRMKGV FVPTPSPYDL SPVARSQTSV MVGDGGVQPE SHPLSGNSVD  240
TLNDKQVVDI PSKLSERNFA GTPYVPVYVM LPLGVINMKC ELVDPDGLLK QLRTLKSVNV  300
DGVMVDCWWG IVEAHAPLEY NWSGYRRLFQ MIRELKLKLQ VVMSFHECGG NVGDDVCIPL  360
PHWVAEIGRH NPDIFFTDKE GRRNPECLSW GIDKERVLRG RTALEVYFDY MRSFRIEFDD  420
LFEDGIISMI EVGLGPCGEL RFPSCPVKHG WRYPGIGEFQ CYDQYLLKSL RKAAEARGHS  480
FWARGPENAG SYNSQPHETG FFCDGGDYDG YYGRFFLNWY SQLLVSHGDR VLSLAKLAFE  540
GTCIAAKLSG IYWWYKTASH AAELTAGFYN PCNRDGYAAI MAMLKKHGAA LNFACAELHI  600
LNQHEDLAGA LADPDGLTWQ VLNAAWDVNV PITTENALPC YGRIEYNKIL DNAKPLNDPD  660
GRHLSSLIYL RLSTTLMDRQ NFMEFEHFVK KMHEKKMEES RRIFITEDSL AEGWWRMMVA  720
LFEMLGRKFE VLGQPKMLKS STHKEEHCVS VVHNTIPSML *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wds_A1e-15126469311442Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051814.10.0Beta-amylase 7
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A061DV680.0A0A061DV68_THECC; Beta-amylase
STRINGVIT_15s0046g02640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29452535
Representative plantOGRP4345912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7