PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_177.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 67aa    MW: 7442.78 Da    PI: 11.3251
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_177.14genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF892.5e-281059251
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsstgkly+++s
  evm.model.supercontig_177.14 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVMIFSSTGKLYDFAS 59
                                  8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.371161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-28261IPR002100Transcription factor, MADS-box
CDDcd002657.04E-37260No hitNo description
PRINTSPR004048.2E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVMIFSS TGKLYDFAST  60
RSFFLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-19160160MEF2C
5f28_B4e-19160160MEF2C
5f28_C4e-19160160MEF2C
5f28_D4e-19160160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_177.14
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021283893.12e-36MADS-box transcription factor 27-like
SwissprotQ6EP491e-31MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A251RHN11e-36A0A251RHN1_PRUPE; Uncharacterized protein
STRINGevm.model.supercontig_177.145e-40(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.11e-33AGAMOUS-like 44
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]