PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_17.38
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 168aa    MW: 19206.1 Da    PI: 10.4155
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_17.38genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.27e-21958150
                                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                 k ien+s r +tfskRr g++KKA+EL  LC+++ a+ i+s+tg+ly + 
  evm.model.supercontig_17.38  9 KLIENNSSRRITFSKRRVGLFKKASELVSLCAVQMAIAIYSPTGTLYSFG 58
                                 569********************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.88E-24173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.88161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-25160IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-17323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-201157IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGRKKIPMKL IENNSSRRIT FSKRRVGLFK KASELVSLCA VQMAIAIYSP TGTLYSFGSP  60
SVDQIFQHFS SKKENSNGVP IDAQHATRVQ NLNQQLDHLQ DQLENQRKRK LVLRQQIKNS  120
EFEKNIQQID ELSPTEVSEM YASLQDMYNK VKEQIKKKET SPVPPIK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_17.38
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGevm.model.supercontig_17.381e-120(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-24AGAMOUS-like 29