PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1643.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 112aa    MW: 13163.6 Da    PI: 11.1581
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1643.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF497.6e-161050242
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                   i+nk+ r+vtf +R++g++KK +ELS LC++   v+++s+
  evm.model.supercontig_1643.1 10 HISNKIVRKVTFNRRKKGLFKKVSELSPLCGVSTRVVLYSP 50
                                  69*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.96149IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-17160IPR002100Transcription factor, MADS-box
CDDcd002662.96E-19275No hitNo description
SuperFamilySSF554553.14E-21396IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MAKKKIKISH ISNKIVRKVT FNRRKKGLFK KVSELSPLCG VSTRVVLYSP YSTEPKVWPS  60
PTGVNQILME FNGMSQNMRN KKIWSHETFL KERLKKINNQ LKKLHKEKHD ND
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_1643.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGevm.model.supercontig_1643.12e-76(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.18e-24AGAMOUS-like 38