PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_161.44
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 465aa    MW: 50248 Da    PI: 7.5379
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_161.44genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.8e-3968127261
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   ++k+l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  evm.model.supercontig_161.44  68 PDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKQF 127
                                   7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3061125IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3170126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.82672126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
ETRSEIAKSE ANGLLQGDAF PSEKSSSFIN IKNEQKSSMQ MNQEQASKQK EDQTETNSAD  60
QERVFKKPDK ILPCPRCNSL DTKFCYFNNY NVNQPRHFCK NCQRYWTAGG TMRNVPVGAG  120
RRKNKQFASQ YRQILVSSDG VPISRLENTE SPNHQLLPSG DSAAAFRPSM GNGTVLKFGP  180
EAPLCESMDS VLNLGEHKRS IEMSSVNCGE NGREPSSCGS PLTASSSRGS GIPGNISQNE  240
QGNFSGTCKE PNSQQPLPCY PVSPLVFPWN PGWNNVTPVA ASQHSSQPVS TANVNNQNPI  300
QWCSTPMVAV PGFCPPNIAL QFVPASYWGC MPVWTAGTGN MPLAASNGCL SPSSSTSNSC  360
CSGNSSPTLG KHSRDPNFKE EAQSEKSILV PKTLRIDDPD EASKSPIWAT LGIKLDQKDP  420
ISRTAIFKAL ETKADGKDHV LDGSHILEAN PAALSRSHTF QESS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_161.44
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021888762.10.0cyclic dof factor 2-like
TrEMBLA0A061F7F70.0A0A061F7F7_THECC; Cycling DOF factor 2, putative isoform 1
STRINGevm.model.supercontig_161.440.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM155911017
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-65cycling DOF factor 2