PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_150.28
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 218aa    MW: 23596.9 Da    PI: 10.7576
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_150.28genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                   Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  evm.model.supercontig_150.28 135 CSHCQVQKTPQWRAGPLGAKTLCNACGVRYKSGR 168
                                   *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.8E-691214IPR016679Transcription factor, GATA, plant
SMARTSM004012.0E-13129179IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.9E-14131192No hitNo description
Gene3DG3DSA: finger, NHR/GATA-type
PROSITE profilePS5011411.213133165IPR000679Zinc finger, GATA-type
CDDcd002021.21E-12134183No hitNo description
PfamPF003209.6E-17135168IPR000679Zinc finger, GATA-type
PROSITE patternPS003440135160IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021889298.11e-158GATA transcription factor 5-like, partial
SwissprotQ9FH573e-49GATA5_ARATH; GATA transcription factor 5
TrEMBLB9HRG74e-71B9HRG7_POPTR; GATA transcription factor
STRINGevm.model.supercontig_150.281e-157(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-39GATA transcription factor 7