PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_150.28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 218aa    MW: 23596.9 Da    PI: 10.7576
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_150.28genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.86.9e-19135168134
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                   Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  evm.model.supercontig_150.28 135 CSHCQVQKTPQWRAGPLGAKTLCNACGVRYKSGR 168
                                   *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.8E-691214IPR016679Transcription factor, GATA, plant
SMARTSM004012.0E-13129179IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.9E-14131192No hitNo description
Gene3DG3DSA:3.30.50.107.0E-15133166IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.213133165IPR000679Zinc finger, GATA-type
CDDcd002021.21E-12134183No hitNo description
PfamPF003209.6E-17135168IPR000679Zinc finger, GATA-type
PROSITE patternPS003440135160IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
DDDIAGLEWV SHFVDDSLSD LSLLFPAGKV KSENKGKRRC DPVGPLLVKT SVFALPVPVK  60
ARSKRTRPEN TGRVWPLGSL SSTELSTTSS SSCSTSGFNS VIQRTEGQPA EKRPKKKAAG  120
QPGGLTGGSP FQRRCSHCQV QKTPQWRAGP LGAKTLCNAC GVRYKSGRLF PEYRPACSPT  180
FSVHTHSNSH RKVLELRRRK ELAGPEPPKL TSAVQSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037193.13e-74PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH572e-50GATA5_ARATH; GATA transcription factor 5
TrEMBLB9HRG79e-73B9HRG7_POPTR; Uncharacterized protein
STRINGPOPTR_0009s12620.12e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57392647
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-39GATA transcription factor 7