PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_15.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 288aa    MW: 31148.7 Da    PI: 8.6936
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_15.30genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.5e-393495263
                       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                                 ke+al+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrn+PvGgg+rknk+sss
  evm.model.supercontig_15.30 34 KEHALNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNIPVGGGSRKNKRSSS 95
                                 67899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-272686IPR003851Zinc finger, Dof-type
PfamPF027011.8E-333692IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1343892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDTAAQWPQE IVVKPIEEIV TKPAAIERKV RPQKEHALNC PRCNSTNTKF CYYNNYSLTQ  60
PRYFCKTCRR YWTEGGSLRN IPVGGGSRKN KRSSSSSTSS SSIISSSKKL SDLISAPLQN  120
PNDQAQDLNL SFPATAPQGF ASLSQLVQVP TIDNNNNNNK NQISSTTSTT TTTSTSTATT  180
TQLSALELLT GMSTRGLNSF MPMPIPDPTS VYTSGLTFPL QDLKPTLNFS LDGLGTGYGS  240
LQETNGRLLF PFEDLKQVSS TGEIGQNREQ GDSAGYWTGM LGGSGSW*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_15.30
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021905076.10.0dof zinc finger protein DOF4.6
SwissprotQ8LAP81e-61DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A0D2U9N91e-129A0A0D2U9N9_GOSRA; Uncharacterized protein
STRINGevm.model.supercontig_15.300.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.43e-51Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]