PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_142.59
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 140aa    MW: 16319.6 Da    PI: 10.8791
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_142.59genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.33.9e-145399551
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
                                  ++ rr+++NRe+ArrsR RKk++ e L+  v  L+ eN+aLk +l +
  evm.model.supercontig_142.59 53 RKRRRMISNRESARRSRWRKKQYEEILTAQVNRLTVENRALKHRLGS 99
                                  5789**************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-1349113IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.2E-135198No hitNo description
PROSITE profilePS5021710.4551103IPR004827Basic-leucine zipper domain
PfamPF001705.8E-125399IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.63E-1153104No hitNo description
CDDcd147023.61E-1454103No hitNo description
PROSITE patternPS0003605671IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MFFPEEAVHF QLPVLSSNEI EELLALLQSD HDPVSVNSGS EGSSRTVHVL DERKRRRMIS  60
NRESARRSRW RKKQYEEILT AQVNRLTVEN RALKHRLGSV LNQWMLTWGE NERLKSEVVG  120
LRARLSDLHR VFLVMQSRN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15256RKRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_142.59
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021285085.13e-47basic leucine zipper 4
TrEMBLA0A2P5CWW16e-46A0A2P5CWW1_PARAD; Basic-leucine zipper transcription factor
STRINGevm.model.supercontig_142.591e-95(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122322432
Representative plantOGRP1173246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59530.14e-23basic leucine-zipper 4