PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_139.80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family ARF
Protein Properties Length: 814aa    MW: 89778 Da    PI: 6.7431
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_139.80genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.23.6e-24179280199
                                   EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT-- CS
                            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk 75 
                                   f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L 
  evm.model.supercontig_139.80 179 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLA 258
                                   99****************************963.3445679**************************************** PP

                                   TT-EEEEEE-SSSEE..EEEEE-S CS
                            B3  76 egDfvvFkldgrsefelvvkvfrk 99 
                                   +gD v+F   + +++el+++++r+
  evm.model.supercontig_139.80 259 SGDAVLFL--RGEDGELRLGIRRA 280
                                   ********..449999*****996 PP

2Auxin_resp123.91.1e-40305386182
                    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrs 81 
                                   +a+a+stks+F+v+Y+Pras++eFv++++k+ k++++++++G+Rf+m+fe+eds+err+sG+v+g+ dldp rWpnSkWr+
  evm.model.supercontig_139.80 305 VANAVSTKSMFHVFYSPRASHAEFVIPYQKYIKSITSPICIGTRFRMKFEMEDSPERRCSGVVIGIGDLDPHRWPNSKWRC 385
                                   689****************************************************************************** PP

                    Auxin_resp  82 L 82 
                                   L
  evm.model.supercontig_139.80 386 L 386
                                   9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.03E-44172290IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-40173287IPR015300DNA-binding pseudobarrel domain
CDDcd100173.63E-22177279No hitNo description
SMARTSM010191.7E-23179281IPR003340B3 DNA binding domain
PfamPF023622.9E-22179280IPR003340B3 DNA binding domain
PROSITE profilePS5086313.253179281IPR003340B3 DNA binding domain
PfamPF065078.3E-35305386IPR010525Auxin response factor
PfamPF023093.4E-6677769IPR033389AUX/IAA domain
SuperFamilySSF542773.29E-10685764No hitNo description
PROSITE profilePS5174521.718685767IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MEIDLNYAAT EVVEKSNTNV PCNGDCHKAS GCVSCCLTSS SSSSSSSNSS SAPGSSSPSS  60
IYLELWHACA GPLTSLPKKG NVVVYVPQGH LEQAAAAASA SPFSTMEMPT FDLNPQIFCR  120
VVNVQLLANK ENDEVYTQVT LLPQPEFVGL NSEGKEAAEL GLEEEGRGGS LTKSTPHMFC  180
KTLTASDTST HGGFSVPRRA AEDCFPPLDY KQQRPSQELV AKDLHGVEWR FRHIYRGQPR  240
RHLLTTGWSI FVSQKNLASG DAVLFLRGED GELRLGIRRA ARPRNGLPDA IIAKQNSYPS  300
ILSLVANAVS TKSMFHVFYS PRASHAEFVI PYQKYIKSIT SPICIGTRFR MKFEMEDSPE  360
RRCSGVVIGI GDLDPHRWPN SKWRCLMVRW DEDMVSDHHE RVSPWEIDPS VSLQPLSIQS  420
SPRLKKLRTG MQATPPDNPV TAGGGGFLDF EESVRPSKVL QGQENVGFVS PLYGCDTVNR  480
SLDFDLQSNA HQSLASTRTE NSKISEFMRA QPQTYASFAE SNRFPGVLQG QEICPFRSLR  540
QNADYNIGSW GKSNLNFNSF NIYQATKPSL YPLASEGPRN IYFPYGGIYR AGQDPMIRPY  600
ATNFPRESVT FATSSIQNRI IGDGIRNPSL LKEHKPPENI PTASSFKTNI GCQKEEGFNG  660
TGCKLFGFSL TGETATSNPQ SSGKRSCTKV SKQGSLVRRA IDLSRLNGYD ELLNELERLF  720
SMEGLLRDPD KGWRVLYTDS ENDVMVVGDD PWHEFCDVVS KIHIYTKEEV EKMTLGVIND  780
DTQSCLEQAP VIMEASKSSS VGQPDSSPTV IRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-121444092354Auxin response factor 1
4ldy_B1e-121444092354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_139.80
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021889763.10.0auxin response factor 4 isoform X1
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A1R3HLK20.0A0A1R3HLK2_COCAP; Auxin response factor
STRINGevm.model.supercontig_139.800.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Representative plantOGRP10049811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]