PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_139.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 470aa    MW: 54168.7 Da    PI: 4.2533
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_139.40genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.37.3e-171150342
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                  i n+s r++tf +R++ ++KK +ELS+LCd++++vii+ +
  evm.model.supercontig_139.40 11 ITNDSVRKTTFKRRKKALMKKVSELSTLCDVKACVIIYNP 50
                                  89***********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.5E-22160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.19E-21184IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.203149IPR002100Transcription factor, MADS-box
CDDcd002667.90E-32285No hitNo description
PRINTSPR004042.1E-7323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-161151IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MTRKRVKLAY ITNDSVRKTT FKRRKKALMK KVSELSTLCD VKACVIIYNP YDSQPEVWPS  60
PIGVQHVLVD FKMMSEMEQR NKMMNQESFL CQSITKTTGQ LKKQRKDNRK KEITQVMFQS  120
LMGKPFHQLN LIDLNDLGWL IELHLKEIQM TMETLSMSPQ PQGATDGGMM NGYREISTQI  180
NEDSLPHNLQ QPQAWFIDDM NPQAQQQLQA LFIDDMNPQA SQQRFADDMN PQAQHQLQVW  240
SVDDMNPQAQ QQPQAWLVDD MNPQTQQQSQ AWFADDMNPQ AQQQPQAWFA DDMNPQAQQQ  300
PQAWLADDMN PQAQQQPQAW LADDMNPQAL QQLQAWLAGD MNPQAQQQPQ AWLADDMNPQ  360
TQQQPQAWLA DDMNPQAQQQ PYAWFVDDMN PQAQQQLQAL YIDGTNLQAP QQPQAWFIDD  420
MTPQTQQELQ ALFIDDTNPQ AQQQLQACFA DDMNPQAQQQ PHLGFGNRD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKRVKLAYITNDSVRKTTFKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_139.40
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGevm.model.supercontig_139.400.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-54AGAMOUS-like 80