PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_136.56
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family CO-like
Protein Properties Length: 444aa    MW: 47983.5 Da    PI: 6.6736
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_136.56genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.25.1e-06444539
                      zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                                  +C+ +e+++   +C+++  +lC +C  + H+       H++
  evm.model.supercontig_136.56  4 MCDFCEDQRSMVYCRSDAACLCLSCDRNVHSAnalskrHSR 44
                                  7*****************************65677777776 PP

2zf-B_box21.64.5e-074689441
                      zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                                   +C++++++++   C + +  lC++C    H +      H++++
  evm.model.supercontig_136.56 46 LICERCNSQPALVRCAEEKASLCQNCDWVVHGNstsastHKRQT 89
                                  68*************************99995588888898776 PP

3CCT61.82.1e-21386429144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   R +a++RYkeK+ktRkF+K++rY+sRKa+A+ R RvKGrFvk+ 
  evm.model.supercontig_136.56 386 RSNAVMRYKEKKKTRKFDKRVRYASRKARADVRRRVKGRFVKAG 429
                                   899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.698147IPR000315B-box-type zinc finger
CDDcd000213.17E-7347No hitNo description
SMARTSM003362.1E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501199.2294390IPR000315B-box-type zinc finger
CDDcd000211.88E-64790No hitNo description
SMARTSM003360.144890IPR000315B-box-type zinc finger
PfamPF062035.3E-16386428IPR010402CCT domain
PROSITE profilePS5101715.398386428IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MGFMCDFCED QRSMVYCRSD AACLCLSCDR NVHSANALSK RHSRTLICER CNSQPALVRC  60
AEEKASLCQN CDWVVHGNST SASTHKRQTI SCYSGCPSAA ELSSIWSFVL ELPSTGESTC  120
EQELGLMSIT ENRAKNSWGP SDNPISQNAG VVDGKDVRNS DKSGHLIGSS SAPGPNSAPR  180
NLDQLLGSSN ATLAKLQYPH FATEDKREFK GGSDVRNKIV PYPKSCSPGT KGLGFCEDDL  240
YGDFLMDEVD LNLENYEELF GVTLNHSQEL FENGGLDSLF GTKDISAAES NCPGAVAAEG  300
SSVGLVSAMQ PACSNAASAD SVMSTKTEPI VRFTARQGHS NLSFSGLTGE SSGGDYQDCG  360
ASSMLLMGEP PWLPSCPEGS LQSVSRSNAV MRYKEKKKTR KFDKRVRYAS RKARADVRRR  420
VKGRFVKAGD AYDYDPLNQT RSC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_136.56
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021889964.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_021889965.10.0zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE51e-154COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A061DL860.0A0A061DL86_THECC; B-box type zinc finger protein with CCT domain isoform 1
STRINGevm.model.supercontig_136.560.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-126CONSTANS-like 9