PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_130.63
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 171aa    MW: 19017.2 Da    PI: 5.5858
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_130.63genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA32.89.7e-113063134
                          GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                                  C +C++t+T +  +g+dg+k LC aCG+ yrk+ 
  evm.model.supercontig_130.63 30 CIHCRSTETFHLGNGSDGPKYLCDACGIDYRKEQ 63
                                  99******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004010.00872476IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.52E-62764No hitNo description
Gene3DG3DSA:3.30.50.102.9E-72863IPR013088Zinc finger, NHR/GATA-type
PfamPF003202.9E-93063IPR000679Zinc finger, GATA-type
PROSITE profilePS5152511.87785167IPR027353NET domain
PfamPF170352.1E-13109157IPR027353NET domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MASTSKHSDL KSSDVPLSNK GRSNVVQKRC IHCRSTETFH LGNGSDGPKY LCDACGIDYR  60
KEQTFHSGMH LGADEENGEL DDDLQFLLEN DGHQVEEAMK KYSAELSATK LPSGSLDRVV  120
EIIKRHKQAE EGSCDEVSVD LEQQDNVTLW RLYFYVKAVE KAAKLVPSRV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446666.13e-42hypothetical protein CICLE_v10015858mg
RefseqXP_006470199.16e-42PREDICTED: uncharacterized protein LOC102630506 isoform X1
RefseqXP_006470198.16e-42PREDICTED: uncharacterized protein LOC102630506 isoform X1
TrEMBLA0A067ECP47e-42A0A067ECP4_CITSI; Uncharacterized protein
TrEMBLV4UCB73e-42V4UCB7_9R
STRINGVIT_14s0066g00150.t015e-37(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM452023
Representative plantOGRP940022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36620.13e-08GATA transcription factor 19