PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_129.55
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 293aa    MW: 32300.2 Da    PI: 8.4812
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_129.55genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.6e-19147201256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  evm.model.supercontig_129.55 147 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 201
                                   788899***********************************************98 PP

2HD-ZIP_I/II125.23e-40147236191
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+
  evm.model.supercontig_129.55 147 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQ 227
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreel 91 
                                   ke +eL+ +l
  evm.model.supercontig_129.55 228 KELQELK-AL 236
                                   ******9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-18141204IPR009057Homeodomain-like
PROSITE profilePS5007117.459143203IPR001356Homeobox domain
SMARTSM003891.0E-15145207IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-17147201IPR009057Homeodomain-like
PfamPF000463.3E-16147201IPR001356Homeobox domain
CDDcd000861.24E-17147204No hitNo description
PROSITE patternPS000270178201IPR017970Homeobox, conserved site
SMARTSM003405.7E-26203246IPR003106Leucine zipper, homeobox-associated
PfamPF021835.6E-10203237IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGLDDSCHTG LVLGLGFASS SPADQIICNP SRNNNSTSGN VKKPANLKLD HYNQMEPSLT  60
LSLISGESIY QAAAVGGRKV DHVNRGGCEE NYSGGDHLYR QASPHSAVSS FSGGRVKRER  120
DLSGDEVEVE RVSSRVSDED EDGVNARKKL RLTKEQSALL EESFKQHSTL NPKQKQALAR  180
QLNLRPRQVE VWFQNRRART KLKQTEVDCE FLKKCCETLT DENRRLQKEL QELKALKLAQ  240
PFYMHMPAAT LTMCPSCERI GAGASDGNSK SPFSMAPKSN FYNPFTNSSA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195203RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_129.55
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021890508.10.0homeobox-leucine zipper protein HAT22-like
SwissprotP466041e-108HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A061DHW31e-147A0A061DHW3_THECC; Homeodomain-leucine zipper protein HD4
STRINGevm.model.supercontig_129.550.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-88HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]