PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_128.41
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 500aa    MW: 53560.2 Da    PI: 7.3397
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_128.41genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96.2e-40149209262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  evm.model.supercontig_128.41 149 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSS 209
                                   7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31146206IPR003851Zinc finger, Dof-type
PfamPF027012.8E-32151207IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.947153207IPR003851Zinc finger, Dof-type
PROSITE patternPS013610155191IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MFESKDTAIK LFGKTIPLPI LNHQIVSPNH SSSLTLDHAT AAVTADHTSP SAIFLPQDTT  60
GGSSTDGNGG DQNKKFQENS GEQVIEDKQE GNTSDHSAED LKEPATTSSG ISENPKTSSA  120
DRETSSLKSA NNGEQSDTSS SQEKTLKKPD KILPCPRCNS MDTKFCYYNN YNVNQPRHFC  180
KNCQRYWTAG GTMRNVPVGA GRRKNKSSSA SHYRHIMVSE ALRAAQVSAS NAIHKASLGN  240
TGTILNFGST DSPLCESVAS VLKLSEKPQN CAQNGFHLSE QRILISSGAT ADTADDHSTM  300
NSSEKGHEAA AAKNYQAYPP QMPCFPGPPW PYPWNSSIPP PPAFCPSGFP VSFYPPPTYW  360
SCAVPPPWSV PFITSPPSSL NQSPQSSGPS SPTLGKHSRD GNILSTPSNT EKEQPSTDTE  420
KTVLVPKTLR IDDPREAAKS SIWATLGIKA ENKSSSNGGG LFKGFQSRAD DRNCMAEASP  480
VLQANPAALS RSLNFHESI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_128.41
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021890593.10.0cyclic dof factor 1-like isoform X1
TrEMBLA0A2K1ZE600.0A0A2K1ZE60_POPTR; Uncharacterized protein
STRINGevm.model.supercontig_128.410.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.18e-84cycling DOF factor 3