PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_126.31
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Trihelix
Protein Properties Length: 553aa    MW: 62701.7 Da    PI: 5.9435
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_126.31genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.97.7e-30377462186
                      trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                                   rW k ev aLie+r+++e+r+++   k+p Weevs+ m++ g++r++k+Ckekwen+nk+++k ke+ +++ s +s+tcpy
  evm.model.supercontig_126.31 377 RWLKAEVEALIEVRSSLETRFQEPGVKAPVWEEVSSLMASMGYQRNAKRCKEKWENINKYFRKAKESGRSKLSLNSKTCPY 457
                                   8******************************************************************************** PP

                      trihelix  82 fdqle 86 
                                   fd+l+
  evm.model.supercontig_126.31 458 FDKLD 462
                                   ***98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138371.6E-21376464No hitNo description
CDDcd122031.60E-23376441No hitNo description
PROSITE profilePS500906.841376434IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MQPSYGLPQT TPHQHQHEQT VPMDIGVCSS SLFSISNPLY QPQKQPQNLF QLLQQHHHHQ  60
LQPFQQQDPF FPLNFKLGLN DNATANKEAL LTQQFTSSFL QGAHSVAVVP PPWNPQEDSA  120
AIKEPIWKPL EKEVINSGNI ECNDNKEQEM EGKNGKKSAF REVDESSGRR KNLENKCRLF  180
GELEAIYSRA NIGELNNQTG SGSALTGQNS PTIQCSNNHC ENVDAGIAGA GVDPGSDISI  240
GREASLWKTQ KRKKKKKRNL REHLGSMTGF FEMLVKQVMD HQEGLQRKFM EAIEGIEKER  300
TRREDSWRRQ QVEKHNREAI ARAHEQAVAS NREAIIISYI EKITGQSLNL PCRNPPMLFQ  360
PEIKRPKEPV NADSNSRWLK AEVEALIEVR SSLETRFQEP GVKAPVWEEV SSLMASMGYQ  420
RNAKRCKEKW ENINKYFRKA KESGRSKLSL NSKTCPYFDK LDQLYFSTPL RRFTKSDDEE  480
AVRQGYSEVS DALVSGKESG NSEYGEMGSS KLNLDGIADE EESQEKENLN HEYGKDSEQE  540
DCRSDDDDDG EE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1251257RKKKKKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_126.31
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021890753.10.0trihelix transcription factor GTL1-like
TrEMBLA0A251IZR61e-143A0A251IZR6_MANES; Uncharacterized protein
STRINGevm.model.supercontig_126.310.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.25e-49Trihelix family protein