PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_126.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 203aa    MW: 23383 Da    PI: 10.3774
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_126.16genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.45.8e-161157349
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                                   e    r+  fskR++gil KA+E Sv Cd++ a+++fs+++k  +y
  evm.model.supercontig_126.16 11 LETLKERHAKFSKRKKGILNKAKEFSVICDIDLALVMFSPSDKPVTY 57
                                  5666789999******************************9998777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.016161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-20160IPR002100Transcription factor, MADS-box
CDDcd001207.94E-17258No hitNo description
SuperFamilySSF554551.57E-18282IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-13323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-161557IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-132338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-133859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGKRKLVIKR LETLKERHAK FSKRKKGILN KAKEFSVICD IDLALVMFSP SDKPVTYFAH  60
DKDLGYFVEK MEKTSARDLE ERRESTNKLL KKIFQKNVEA EVDVRSFSAD GDDTVKVQEA  120
QLEEMKNRLD ERRKALEDFK NPRNVQDLNQ IKSMKEHLIT SLERIQKKKN RLLGKYQMER  180
VINASSGPGA VNLAHGTFGD KN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_126.16
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021890718.11e-146agamous-like MADS-box protein AGL30
TrEMBLF8WLD63e-49F8WLD6_CITUN; MADS-box protein
STRINGevm.model.supercontig_126.161e-145(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73301838
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-23AGAMOUS-like 65