PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1246.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 306aa    MW: 34216.1 Da    PI: 6.7836
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1246.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33e-19154208256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++k+q  +Le+ F+ + +++ ++++ LA++l+L  rqV vWFqNrRa+ k
  evm.model.supercontig_1246.1 154 RKKLRLSKQQAAILEDSFRDHTTLNPKQKQALAEQLNLRPRQVEVWFQNRRARTK 208
                                   788899***********************************************98 PP

2HD-ZIP_I/II1216.2e-39154242190
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlsk+q+++LE+sF+ +++L+p++K++la++L+l+prqv+vWFqnrRARtk+k++E+d+e Lk+++++l+een+rL+
  evm.model.supercontig_1246.1 154 RKKLRLSKQQAAILEDSFRDHTTLNPKQKQALAEQLNLRPRQVEVWFQNRRARTKLKKTEVDCELLKKCCETLTEENKRLQ 234
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLree 90 
                                   kev+eL+ +
  evm.model.supercontig_1246.1 235 KEVQELK-S 242
                                   ******9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-18134208IPR009057Homeodomain-like
SuperFamilySSF466894.28E-18136211IPR009057Homeodomain-like
PROSITE profilePS5007117.07150210IPR001356Homeobox domain
SMARTSM003895.7E-16152214IPR001356Homeobox domain
CDDcd000867.05E-16153211No hitNo description
PfamPF000461.5E-16154208IPR001356Homeobox domain
PROSITE patternPS000270185208IPR017970Homeobox, conserved site
SMARTSM003404.9E-22210253IPR003106Leucine zipper, homeobox-associated
PfamPF021832.0E-8210243IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MVFSSDTDQN PTCDTGLGLA LCGRHERPNQ ENIKKNITLL ASLRYDDHLL PSDLSLGLKS  60
QDHHHVNQMV DDHRAGEASI GDVKDQVQQN QASSLSTEGV SSFSNSNSVK KETREYCNSG  120
SEEVEVEKIN YCSRVSSDDQ HEDHNHDQED GSPRKKLRLS KQQAAILEDS FRDHTTLNPK  180
QKQALAEQLN LRPRQVEVWF QNRRARTKLK KTEVDCELLK KCCETLTEEN KRLQKEVQEL  240
KSLKLTASFY MHLPAATLMT MCPSCERLGS STHGGDGSSG NPLIPISPKP HHLYNSFSHP  300
PSAAC*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_1246.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021894218.10.0homeobox-leucine zipper protein HAT22-like
SwissprotP466041e-70HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A2C9VXJ53e-84A0A2C9VXJ5_MANES; Uncharacterized protein
STRINGevm.model.supercontig_1246.10.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-66HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]