PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_117.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 186aa    MW: 21303.4 Da    PI: 8.4611
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_117.24genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF412.4e-131150342
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                  i nk+ r+v f +R++g+lKK +EL +LC++++ ++++s+
  evm.model.supercontig_117.24 11 IGNKTTRKVIFNQRKKGLLKKVSELTTLCGVNAGIVLYSP 50
                                  88************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.582149IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-19160IPR002100Transcription factor, MADS-box
CDDcd002661.04E-25283No hitNo description
PRINTSPR004041.5E-6323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-21394IPR002100Transcription factor, MADS-box
PfamPF003194.7E-141150IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MAKKKIKIAL IGNKTTRKVI FNQRKKGLLK KVSELTTLCG VNAGIVLYSP YSAEPDVWPS  60
PTRVNQILTD FNEMSEIQHS KKMLSHEAFL EERLNKINNQ LEKLYKKNRD NEVMLMLSEC  120
LAGKSPNNLD TRDLKDLECM IHQLMTNFQE NKYKLEETSH NPQEVGKEIQ PNSEDDNQVA  180
DQTKP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_117.24
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGevm.model.supercontig_117.241e-135(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.11e-35AGAMOUS-like 38