PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_117.23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 170aa    MW: 19440.9 Da    PI: 10.7146
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_117.23genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.87.9e-151050242
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                  +i n+  r+vtf kR +g+lKK +EL +LC++++ vii+ +
  evm.model.supercontig_117.23 10 FIVNDKARKVTFNKRMKGLLKKLSELTILCGVNAGVIIYNP 50
                                  799***********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.7E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.185149IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-22394IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-10323IPR002100Transcription factor, MADS-box
CDDcd002661.54E-24385No hitNo description
PfamPF003198.6E-171050IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MVRKKIKIAF IVNDKARKVT FNKRMKGLLK KLSELTILCG VNAGVIIYNP YSMKLEVWPS  60
AMGVQQVLTD FNNISEINRN KKMVNQGVFL EEGIKKMNDQ VEKQHKKNRE NEIMQLLFKH  120
LTGKSANNTN KRDLKELGFL IQRLLKNIQE VKDKLIKASR DVQGAGEDV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225RKKIKIAFIVNDKARKVTFNKRMK
21631RKVTFNKRMKGLLKKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_117.23
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382260.27e-52agamous-like MADS-box protein AGL80
TrEMBLU5GF697e-51U5GF69_POPTR; Uncharacterized protein
STRINGevm.model.supercontig_117.231e-118(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-37AGAMOUS-like 80