PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_116.43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 618aa    MW: 66672.9 Da    PI: 4.9635
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_116.43genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS458.54e-1402496121374
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   lv++L++cAeav++++++la+al++++  la++++ +m+++a+yf+eALa+r++r    +y    p++ + ++s + +  +
  evm.model.supercontig_116.43 249 LVHTLVACAEAVQQENMKLADALVKHIGLLAASQAGAMKKVATYFAEALARRIYR----VY----PQDGTLDSSYSDIL-Q 320
                                   689****************************************************....44....44444333333333.3 PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                     f+e++P+lkf+h+taNqaIlea+++++rvHiiDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g
  evm.model.supercontig_116.43 321 MHFYETCPYLKFAHFTANQAILEAFASANRVHIIDFGLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPSNTDALQQVG 401
                                   46******************************************************************************* PP

                          GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   ++La++Ae++gv+fef+ +va++l+dle+e+L ++p   Ea+aVn+v++lhrll++++ +++    vL  +k ++Pk+++v
  evm.model.supercontig_116.43 402 WKLAQLAETIGVDFEFQGFVANSLADLEPEMLGIRPaeIEAVAVNSVFELHRLLARPGGIDK----VLTSIKAMKPKIITV 478
                                   ************************************9899**************99998888....*************** PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   veqea+hn++ Fl+rf eal+yys+lfdsle +   + +++ ++++ +lg++i+nvvacega+r+erhetl +Wr r+e+a
  evm.model.supercontig_116.43 479 VEQEANHNGPVFLDRFNEALHYYSSLFDSLEGSGLGTPSQDLVMSELYLGKQICNVVACEGADRVERHETLTQWRTRMESA 559
                                   ******************************7776677789999999*********************************** PP

                          GRAS 323 GFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   GF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  evm.model.supercontig_116.43 560 GFDPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLGWHTRPLIATSAWQ 612
                                   ****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.6E-3842115No hitNo description
PfamPF120414.7E-3842109IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098569.427223591IPR005202Transcription factor GRAS
PfamPF035141.4E-137249612IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MKREHKETGS NTGGGVKGET SSMAGGGKGK LWEEEQDAGG MDELLAVLGY KVRSSDMADV  60
AQKLEQLEMV IGSAQEDGIS HLACDTVHYN PSDLSGWVQS MLSEFNNSPS GNLDPTMVLQ  120
NQSIQDSVGL TSLDSNSVNS IHYSNNSQAK KSERIDTHSQ IYHDDSEYDL RAIPGVAAYP  180
SRDDSETENS RKRIKTTLGS ASGSSPSPSP SAGLLTSSSS SSTIGISTAI PDSARPVVLI  240
DSQETGVRLV HTLVACAEAV QQENMKLADA LVKHIGLLAA SQAGAMKKVA TYFAEALARR  300
IYRVYPQDGT LDSSYSDILQ MHFYETCPYL KFAHFTANQA ILEAFASANR VHIIDFGLKQ  360
GMQWPALMQA LALRPGGPPA FRLTGIGPPQ PSNTDALQQV GWKLAQLAET IGVDFEFQGF  420
VANSLADLEP EMLGIRPAEI EAVAVNSVFE LHRLLARPGG IDKVLTSIKA MKPKIITVVE  480
QEANHNGPVF LDRFNEALHY YSSLFDSLEG SGLGTPSQDL VMSELYLGKQ ICNVVACEGA  540
DRVERHETLT QWRTRMESAG FDPVHLGSNA FKQASMLLAL FAGGDGYRVE ENNGCLMLGW  600
HTRPLIATSA WQLAASE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-602496124375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383329.10.0hypothetical protein POPTR_0005s14540g
SwissprotQ84TQ70.0GAI_GOSHI; DELLA protein GAI
TrEMBLU5GFQ30.0U5GFQ3_POPTR; Uncharacterized protein
STRINGPOPTR_0005s14540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0RGA-like 2