PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1117.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 306aa    MW: 34108.7 Da    PI: 9.3652
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1117.2genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.32.6e-3656112359
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                   e+ lkcprCdstntkfCyynny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr++++
  evm.model.supercontig_1117.2  56 ESPLKCPRCDSTNTKFCYYNNYNKSQPRHFCKTCKRHWTKGGTLRNVPVGGGRKNKR 112
                                   5789***********************************************976665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2356112IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3158111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.52159113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGLSSKQVSS DDHGLDWNQT LLQATTTSEF PKASSSLKRQ HPQNNQSNNN QQKVAESPLK  60
CPRCDSTNTK FCYYNNYNKS QPRHFCKTCK RHWTKGGTLR NVPVGGGRKN KRLKTSNDTV  120
STATNGKISN KLGYMGIRNQ ELPNLGFNDQ KTLSDMLYRR MIQPAKSPLQ NSTMFVGSSS  180
NSLTLSPLNA HHHHHHHHHH QALHFPFSSS SSSSFETNPS SVSTSLHSST LYNLTTGDEQ  240
TKGNDVVPTI TSMLMPTTTV LAQSWQSQSA TASMEIGNYW NWDDIDTFVS THDLNIPWDD  300
SDIKP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_1117.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021895858.10.0dof zinc finger protein DOF5.6-like
TrEMBLA0A2C9U4V33e-87A0A2C9U4V3_MANES; Uncharacterized protein
STRINGevm.model.supercontig_1117.20.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-31TARGET OF MONOPTEROS 6