PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1046.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 355aa    MW: 40299.5 Da    PI: 4.586
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1046.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.84.2e-161552643
                                  HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                        SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                  + +r v+f+kRrng++ KA EL+ LC+a++a+++ s+ 
  evm.model.supercontig_1046.4 15 QEQRAVSFTKRRNGLFNKAAELCMLCGAQIALLVSSPI 52
                                  5689******************************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-18161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.988262IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-10424IPR002100Transcription factor, MADS-box
CDDcd002662.23E-18581No hitNo description
SuperFamilySSF554553.4E-17578IPR002100Transcription factor, MADS-box
PfamPF003192.8E-151659IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-102439IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-103960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGRSRKIPME RRGTQEQRAV SFTKRRNGLF NKAAELCMLC GAQIALLVSS PISKKESFYS  60
FGHSSVDAVI YAFLNGTTPN PVQDDVKNSA VSVYQATKAL ESQPEIWDTD NRKRKRDVKQ  120
FWPDLEDLAD DCRSIEDIRF AIDRLQELKD KVQVRLDKNR NNQEEISKHH VRSEYAQDDD  180
GVDNPTLDLL QFFSSRPTID FNSELEEREG RNDDRITAGI NIFSESDETE DETAGEGEGE  240
GEGEGEDERE QSVSHSSATS FHKRKQNPTE ESERYTLFRD EVAAGGENSL LVQRITEVFG  300
ELQKVKGLTQ SEINQASIRL TSNPSYLLLF FSIPSEYRLG WVRSFLSENI MCVD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_1046.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021896792.10.0agamous-like MADS-box protein AGL62
STRINGevm.model.supercontig_1046.40.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17339310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49490.13e-21AGAMOUS-like 83