PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_104.84
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family TCP
Protein Properties Length: 422aa    MW: 45843.5 Da    PI: 8.0832
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_104.84genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP22.14.9e-07731023564
                           TCP  35 LqdeLGfdkdsktieWLlqqakpaikeltg 64 
                                   L++eLG+ ++++t+eWLl q  p  +  + 
  evm.model.supercontig_104.84  73 LTRELGYRSNGQTVEWLLSQVRPDLILPNP 102
                                   9*******************9998776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.6E-45996IPR005333Transcription factor, TCP
Gene3DG3DSA:3.60.110.101.6E-57134414IPR003010Carbon-nitrogen hydrolase
SuperFamilySSF563173.27E-57135415IPR003010Carbon-nitrogen hydrolase
PROSITE profilePS5026336.456136421IPR003010Carbon-nitrogen hydrolase
PfamPF007951.5E-49137411IPR003010Carbon-nitrogen hydrolase
PROSITE patternPS009200168183IPR000132Nitrilase/cyanide hydratase, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0016810Molecular Functionhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MARVKKSNHQ MEALQQRASK AENADASGSI VNAEEMKNSR KRRRIGGTKA KPETGIRMRV  60
QITPNCCPGI SLLTRELGYR SNGQTVEWLL SQVRPDLILP NPNSLPTHRK QKPVCMAYPE  120
DEKIVDLISG GPRQPVRVTV VQASTVFLDT PATLDKAERL VASAAAYGSQ LVVFPEAFVG  180
GYPYCVMLEA ALVTHSTNEN EEFLNYHASA IDVPGPEVDR LAKIAGRNKV QLVMGVVERV  240
GSYLFSTILF FDSLGQFIGK NQKVRLLASE CAVWWSGGTS SVLVYEGPAG KIGGLVGWDN  300
RIPRLRTELY ARGIEIYCAP AVEARDKWQA SVTHIALEGG CFVLSANQFC RKKDYRLPEY  360
FCGENASQDA IICSGGSVII SPSGTILAGP NFLGESLISA DLDLEEIARA KLEAGIGHNF  420
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wuy_A9e-3113641816297Nitrilase
3wuy_B9e-3113641816297Nitrilase
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13943RKRRR
24044KRRRI
Functional Description ? help Back to Top
Source Description
UniProtHighly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification. {ECO:0000269|PubMed:10574458, ECO:0000269|PubMed:11060302}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_104.84
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by abscisic acid or by 1-aminocyclopropane-1-carboxylic acid (ACC). {ECO:0000269|PubMed:10574458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021892521.10.0bifunctional nitrilase/nitrile hydratase NIT4B-like
SwissprotQ429661e-125NRL4B_TOBAC; Bifunctional nitrilase/nitrile hydratase NIT4B
TrEMBLA0A2N9ICC71e-164A0A2N9ICC7_FAGSY; Uncharacterized protein
STRINGevm.model.supercontig_104.840.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2058756
Representative plantOGRP183523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45150.11e-07TCP domain protein 16
Publications ? help Back to Top
  1. Dohmoto M,Sano J,Tsunoda H,Yamaguchi K
    Structural analysis of the TNIT4 genes encoding nitrilase-like protein from tobacco.
    DNA Res., 1999. 6(5): p. 313-7
    [PMID:10574458]
  2. Piotrowski M,Schönfelder S,Weiler EW
    The Arabidopsis thaliana isogene NIT4 and its orthologs in tobacco encode beta-cyano-L-alanine hydratase/nitrilase.
    J. Biol. Chem., 2001. 276(4): p. 2616-21
    [PMID:11060302]