PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_104.27
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family TALE
Protein Properties Length: 691aa    MW: 74993.7 Da    PI: 8.4276
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_104.27genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-093844211954
                                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                   Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  evm.model.supercontig_104.27 384 FEHflHPYPKDSDKHMLAKQTGLTRNQVSNWFINARVR 421
                                   554459******************************88 PP

2BELL123.21.1e-39248319172
                          BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                   erqe+q+kk kL+s+l+eV++rY+qy++q+q+vissFe++ag+gsa+ Yt+lAlk+iS++FrcLkdai++qi
  evm.model.supercontig_104.27 248 ERQEIQMKKGKLISMLDEVEQRYRQYHHQMQIVISSFEQAAGIGSARTYTALALKTISKQFRCLKDAITGQI 319
                                   79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.8E-64167317IPR006563POX domain
PfamPF075261.7E-49172316IPR006563POX domain
PROSITE profilePS5007112.195362425IPR001356Homeobox domain
CDDcd000861.28E-11365426No hitNo description
SMARTSM003891.2E-8365429IPR001356Homeobox domain
SuperFamilySSF466891.28E-16366431IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28368431IPR009057Homeodomain-like
PfamPF059204.1E-18382421IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MATYFHGNPE IQGPDGLQTL VLMNPTYVQY SDNPPPPQAP PPPQHSNLFF LNSANSLSPH  60
APPPHTQQFV GIPLPATAAT TAAAPQDPAD ISTLHGLLPR LHYNLYNPID PSQSARDNPR  120
APQGLSLSLS SQQPPGFRSQ AQALSAEDMR VSGGSASSGS GVTNGVSGMQ GVLLSSKYLK  180
AAQELLDEVV SVNNNGINNK VELSKKGSGS NNSSNGSKAI GESSVGAGDG LVGGEAGGKR  240
AAELTTAERQ EIQMKKGKLI SMLDEVEQRY RQYHHQMQIV ISSFEQAAGI GSARTYTALA  300
LKTISKQFRC LKDAITGQIR AANKSLGEDD CLGDKIEGSR FKFVDHHLRQ QRALQQLGMI  360
QHNAWRPQRG LPERSVSVLR AWLFEHFLHP YPKDSDKHML AKQTGLTRNQ VSNWFINARV  420
RLWKPMVEEM YLEEIKEQEQ NGSDDKTSKS EHEDSASKSM RPKEKSSVPE TQAKGSLKSK  480
QDSIANQNIP SSMSISTAST SPMGGNLRNQ SGFSLIGPSE LEGITQGSPK KLRSSEMLQS  540
PSSIPSVNMD AKHAEANNEQ ISIKFGDERQ SRDGYSFMGS HNNFIGGYGQ YSLGELGRFD  600
AEQFTPRFSG NGVSLTLGLP HCENLSLSAT HQTFLPSQNI QLGRRVDQLG QPNEFGAINT  660
SAPHSSAAYD NINIQNRKRF AAQLLPDFVA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-16371429563Homeobox protein Meis2
3k2a_B5e-16371429563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027982.10.0BEL1-like homeodomain protein 1 isoform 1
RefseqXP_007027983.10.0BEL1-like homeodomain protein 1 isoform 1
RefseqXP_007027984.10.0BEL1-like homeodomain protein 1 isoform 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A061EUI80.0A0A061EUI8_THECC; BEL1-like homeodomain protein 1 isoform 1
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-165BEL1-like homeodomain 1