PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_104.22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Dof
Protein Properties Length: 298aa    MW: 32512.8 Da    PI: 6.7849
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_104.22genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.2e-372075762
                        zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                  +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rk+++++
  evm.model.supercontig_104.22 20 SCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRAK 75
                                  7***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.631973IPR003851Zinc finger, Dof-type
PfamPF027012.9E-312073IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-232168IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102157IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDRAGWIHHD HHRHHHISPS CPRCGSSNTK FCYYNNYSLT QPRYFCKGCR RYWTKGGSLR  60
NVPVGGGCRK SRRAKSSSRL SNSDHGVLII SKNSGSNTTS THLGYRGNDN DPVQKMDSLA  120
DSSSVMADGS HIDLALVYAN FLNQRPPEPA ADSKSGMIEV AELPASEFGI PSSLGFPYVD  180
ASSSGLNQEN RVLERLNYSD LSADPMVCSS GFDPVQNHEC SSHERSRHDY GLPPLPGEGA  240
AASWPNSSHV IMENDHGIQL AGQDPVLGPD QGQDPNLLFG NWSSFDLSID YAFSRSL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_104.22
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM3665461e-32HM366546.1 Prunus persica clone PpDOF1 Dof-type zinc finger domain-containing protein mRNA, complete cds.
GenBankHM3665471e-32HM366547.1 Prunus persica clone PpDOF2 Dof-type zinc finger domain-containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021892434.10.0dof zinc finger protein DOF3.5
TrEMBLB9SDJ21e-69B9SDJ2_RICCO; Zinc finger protein, putative
STRINGevm.model.supercontig_104.220.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91412238
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.16e-43Dof family protein