PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_103.82
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 472aa    MW: 52885.6 Da    PI: 4.4906
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_103.82genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.92.7e-181453544
                                  SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                        SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                                   k +r vtf+kRr+g++ KA ELSvLCd +vav++ s++ 
  evm.model.supercontig_103.82 14 TKEQRAVTFTKRRHGLFNKAAELSVLCDFQVAVLVSSPNS 53
                                  5789********************************9864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.04253IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-18265IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-20282IPR002100Transcription factor, MADS-box
CDDcd002663.01E-23390No hitNo description
PRINTSPR004042.4E-9424IPR002100Transcription factor, MADS-box
PfamPF003193.2E-161562IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-92439IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-93960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MATKRKIPME KRKTKEQRAV TFTKRRHGLF NKAAELSVLC DFQVAVLVSS PNSPKRTKFY  60
TFGWSSVDTV IDAFLHFRAP PPIENHKKAS VLSLCENIRM LERGRKEIQS LARKKTKKEN  120
LGFWWDVEDF DRNQTFEELD LTISRLENLR ENVMNKLSGS DSLSLSSDDF SLTTQISGSR  180
SATPPPINTA INEYSASLQL LTYSSTDKIS KPEGISDLAA PYSDPANING DNSLPQQFVT  240
SSANNEDYHQ EYHNINCADN LPALQLLDSA SNRTAINEYY ACLQLLTTDI IRKPEEISEL  300
PAPYSYPVNI NGDNSLPQQL VPSSANNEDY HQENYNTNCA DNLPALQLLD SAANRTAING  360
YQDDQVVQQF DYRLTYDGID AAINNDHYQD NQMVEDFEYG LLYNGIKDLT NVSSETPPTS  420
LFSNCTIEYP MNNCNFPANI DGAGTNNANS GLLLADNNWL LCSTIDDYGF F*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_103.82
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGevm.model.supercontig_103.820.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17339310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49420.13e-23M-type_MADS family protein