PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_101.29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 276aa    MW: 30501 Da    PI: 7.0118
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_101.29genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.7e-18124178256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  evm.model.supercontig_101.29 124 RKKLRLSKEQSMVLEETFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 178
                                   788899***********************************************98 PP

2HD-ZIP_I/II127.17.3e-41124213191
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlskeq+ +LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+
  evm.model.supercontig_101.29 124 RKKLRLSKEQSMVLEETFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQ 204
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreel 91 
                                   kev+eLr +l
  evm.model.supercontig_101.29 205 KEVQELR-AL 213
                                   ******9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.5E-29195IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.606.0E-19102178IPR009057Homeodomain-like
SuperFamilySSF466896.42E-19111181IPR009057Homeodomain-like
PROSITE profilePS5007117.394120180IPR001356Homeobox domain
SMARTSM003891.6E-15122184IPR001356Homeobox domain
CDDcd000866.60E-16124181No hitNo description
PfamPF000465.7E-16124178IPR001356Homeobox domain
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
SMARTSM003405.9E-27180223IPR003106Leucine zipper, homeobox-associated
PfamPF021832.2E-11180214IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGERDDDLGL SLSLGGALNE SSLKLNLMTP LASNQQKTIW NELFHSSEGN ADGRPSFRGI  60
DVNRVPSAVE YEEETGVSSP NSTVSSISGK RSEREVIGEE NEAERTSCSR GSDDEDGGNG  120
DASRKKLRLS KEQSMVLEET FKEHSTLNPK QKLALAKQLN LRPRQVEVWF QNRRARTKLK  180
QTEVDCEYLK RCCENLTEEN RRLQKEVQEL RALKLSPHLY MHMTPPTTLT MCPSCERVAV  240
SSSSSSASSA AATTGPSSQR SVPISPWPAI PNHRP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122128SRKKLRL
2172180RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_101.29
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021892744.10.0homeobox-leucine zipper protein HAT3
SwissprotP466021e-109HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A067HCG81e-139A0A067HCG8_CITSI; Uncharacterized protein
TrEMBLA0A2H5NNU81e-139A0A2H5NNU8_CITUN; Uncharacterized protein
TrEMBLV4U8Y01e-139V4U8Y0_9ROSI; Uncharacterized protein
STRINGevm.model.supercontig_101.290.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.11e-87homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  3. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]