PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_100.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 70aa    MW: 7800.23 Da    PI: 10.954
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_100.10genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF321.5e-101149341
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                                  i n+s r+  f kR++g++K  +ELS L +++++ ii+s
  evm.model.supercontig_100.10 11 ITNDSVRKAMFKKRKKGVMKNVSELSALYNVKASAIIYS 49
                                  89************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.31E-14157IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.638149IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-6160IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-6323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-111149IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MTRNKVKLVN ITNDSVRKAM FKKRKKGVMK NVSELSALYN VKASAIIYSL YHPQLEVLAF  60
PTHSPTHVG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12125KKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_100.10
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021771891.15e-18agamous-like MADS-box protein AGL80
RefseqXP_021912469.11e-17agamous-like MADS-box protein AGL80
TrEMBLA0A1S3ZJU34e-14A0A1S3ZJU3_TOBAC; agamous-like MADS-box protein AGL80
STRINGevm.model.supercontig_100.101e-43(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-14M-type_MADS family protein