PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1.45
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 372aa    MW: 41587 Da    PI: 7.5738
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1.45genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.71.5e-182870143
                                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                kr en   rq t++ R++gi+KKA+ELS+LCd+++ +++fs+t
  evm.model.supercontig_1.45 28 KRLENINGRQATYAERKHGIMKKANELSILCDIDIVLLMFSPT 70
                                68899999*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-232080IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.0772071IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-2220103IPR002100Transcription factor, MADS-box
CDDcd002661.29E-2221102No hitNo description
PRINTSPR004043.2E-142242IPR002100Transcription factor, MADS-box
PfamPF003195.1E-153073IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-144257IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-145778IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MEGSKHNGKT SGKVKASCGM GRVKLKIKRL ENINGRQATY AERKHGIMKK ANELSILCDI  60
DIVLLMFSPT SGKPSLCTGR RSSIEEVIAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD  120
VNIQEFMGTS NQTIEDLTNQ ARLLQTQLSE IHRRLSYWTN PEKISNVEHL EQMENSLRES  180
LNQIRAHREN LGKQQLISLE CTSQIQPSMH MPFGMGAEQQ LQPLSWIPNN ENRSIALPEE  240
PNLLPHRDVE CSASSSFGSY SGYFGTGKSS DISNSGQESC ILNDLTGTAQ LRLQMNGHYP  300
YLPYNLNLLN DTKFQPLADI NLQETHVDYH VNGILDAPRP GYDTTQASWA STSGPCAVTV  360
FDDPLFGRQP N*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_1.45
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910461.10.0agamous-like MADS-box protein AGL30 isoform X2
SwissprotQ1PFA41e-120AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A061EA580.0A0A061EA58_THECC; AGAMOUS-like 65
STRINGevm.model.supercontig_1.450.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87542539
Representative plantOGRP59461119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-102AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]