PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1.339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LBD
Protein Properties Length: 162aa    MW: 18112.4 Da    PI: 8.7839
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1.339genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.53.5e-4151041100
                       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82 
                                  +CaaCk+lrr+C++dC+++pyfp+++p++fa+vhk++Gasnv k+l++lp + r +a++sl++eA++r++dPvyG+vg+i+ 
  evm.model.supercontig_1.339   5 RCAACKYLRRRCPQDCIFSPYFPSNNPQRFAFVHKIYGASNVAKMLQQLPSHLRGQAADSLYFEAQCRIEDPVYGCVGIISV 86 
                                  6********************************************************************************* PP

                       DUF260  83 lqqqleqlkaelallkee 100
                                  l++q+++++++la++++e
  evm.model.supercontig_1.339  87 LHNQIQKAENQLARTQAE 104
                                  *************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7084105IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-415102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MASGRCAACK YLRRRCPQDC IFSPYFPSNN PQRFAFVHKI YGASNVAKML QQLPSHLRGQ  60
AADSLYFEAQ CRIEDPVYGC VGIISVLHNQ IQKAENQLAR TQAEIAVYSS RANPLQLPQQ  120
QQFEANPIFI NSSWTKLEQY GTGTSSFAAA NFNYQSPYGF N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-3821098115LOB family transfactor Ramosa2.1
5ly0_B5e-3821098115LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_1.339
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910100.11e-117LOB domain-containing protein 24-like
SwissprotP594688e-56LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A061FP581e-63A0A061FP58_THECC; LOB domain-containing protein 23
STRINGevm.model.supercontig_1.3391e-117(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-58LOB domain-containing protein 24