PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_0.43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 349aa    MW: 40163.5 Da    PI: 9.783
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_0.43genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.71.5e-131653845
                                HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                      SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                 r+ t+ kR++g+ KKA E S+LC+++ ++i+++++ k
  evm.model.supercontig_0.43 16 SRSQTYQKRKKGLKKKALEFSTLCGVDTCMILYGPNHK 53
                                6899******************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.049153IPR002100Transcription factor, MADS-box
SMARTSM004325.9E-11160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-17298IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-7323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-141153IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGRGKLHMEL ITKVYSRSQT YQKRKKGLKK KALEFSTLCG VDTCMILYGP NHKGQTRKAE  60
VWPDSPSEVF RIIGKYKAKA FDSHAVRSFD LFDFFSRRNK KIQDDILKLR KTNITAKFPT  120
WNNSLNNLSL DQIKALLIKF DAVLEVVKMK VMMIKEDKRL IDESSIIPCI NPINNFRKDS  180
SLQKEMKPEA VSTYLKPYGA MQIMPQFSPA DQTTLYNQIA VQQVDHHVNS LDHYNQMIMM  240
MMVMNGSDQF TQFSCNTNNN NNNNNNNDKI NNSFYSLSSS KVMKDVMFSN QMVRPRMCLY  300
EPLMQPVPPF GHCNMMLPRP SNSSQVLMGS QFSEFYCGIN EDDQSKIV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_0.43
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910630.11e-177agamous-like MADS-box protein AGL82
STRINGevm.model.supercontig_0.430.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16227914
Representative plantOGRP3677621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.15e-19M-type_MADS family protein