PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_46342.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MIKC_MADS
Protein Properties Length: 127aa    MW: 14413.9 Da    PI: 9.2328
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_46342.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.52.2e-102251942
                           HHHHHHHHHHHHHT-EEEEEEE-T CS
                 SRF-TF 19 gilKKAeELSvLCdaevaviifss 42
                           g++KK + L++LCd++++vii+s+
  evm.TU.contig_46342.1  2 GLMKKVSKLCTLCDVKACVIIYSP 25
                           9**********************8 PP

2K-box17.71.4e-0745912673
                  K-box 26 keienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73
                           +  ++L+ eq + +G++L++L+l +L+ L   +e+ +k+i + K+e l
  evm.TU.contig_46342.1 45 DFKRMLEMEQSKKMGKSLHQLNLIDLNDLGWLIEQHVKEIQK-KMETL 91
                           56689***********************************75.55554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002662.16E-17258No hitNo description
SuperFamilySSF554554.19E-11264IPR002100Transcription factor, MADS-box
PfamPF003191.4E-8226IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MGLMKKVSKL CTLCDVKACV IIYSPYDSQP DVWPSPLGAQ HMLADFKRML EMEQSKKMGK  60
SLHQLNLIDL NDLGWLIEQH VKEIQKKMET LNKSPQPQEV RDGGVMKGPS ETFTQIKENS  120
RVKKLQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_46342.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910735.14e-86agamous-like MADS-box protein AGL80, partial
TrEMBLA0A2H5NT822e-32A0A2H5NT82_CITUN; Uncharacterized protein
TrEMBLV4S7963e-32V4S796_9ROSI; Uncharacterized protein
TrEMBLV4SWL02e-32V4SWL0_9ROSI; Uncharacterized protein
STRINGevm.TU.contig_46342.19e-89(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-23AGAMOUS-like 80