PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_41047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 104aa    MW: 11661.7 Da    PI: 10.862
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_41047.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.5e-181448135
                   GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                           Cs+C +  Tp+WR gp g+ktLCnaCG++y++ +l
  evm.TU.contig_41047.1 14 CSHCLAQRTPQWRAGPMGPKTLCNACGVRYKSGRL 48
                           *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.1E-16862IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.332844IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.81E-151271No hitNo description
Gene3DG3DSA:3.30.50.108.9E-151246IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.70E-111360No hitNo description
PROSITE patternPS0034401439IPR000679Zinc finger, GATA-type
PfamPF003201.1E-151448IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MVMESEKVQQ VRRCSHCLAQ RTPQWRAGPM GPKTLCNACG VRYKSGRLLP EYRPAKSPTF  60
VSYLHSNSHK KVLEMRMANT NLHPPPPPPP PPIHLSTLHI KKS*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_41047.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011010123.11e-44PREDICTED: GATA transcription factor 12-like
SwissprotQ9FH572e-34GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A2C9VIF21e-42A0A2C9VIF2_MANES; Uncharacterized protein
TrEMBLA0A2P2JWN97e-43A0A2P2JWN9_RHIMU; Uncharacterized protein MANES_09G142600
TrEMBLA0A2P2JWQ46e-43A0A2P2JWQ4_RHIMU; Uncharacterized protein MANES_09G142600
STRINGevm.TU.contig_41047.13e-70(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17095911
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.27e-38GATA family protein