PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_40499.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 101aa    MW: 11576.7 Da    PI: 10.5885
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_40499.2genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.68e-191152344
                           --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                 SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                           i n+s r+ tf kR++g++KK +ELS+LCd++++ ii+s+ +
  evm.TU.contig_40499.2 11 ITNNSARKATFKKRKKGLMKKVSELSTLCDVKACTIIYSPYN 52
                           89*************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-24160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.731149IPR002100Transcription factor, MADS-box
CDDcd002666.10E-19285No hitNo description
SuperFamilySSF554555.36E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-11323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-191152IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MTRKKVKLAY ITNNSARKAT FKKRKKGLMK KVSELSTLCD VKACTIIYSP YNSQPDIWPS  60
LLEAQHVLAD FKRMPEMAQN KKMVNQESFL CQRITKAIDH *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYITNNSARKATFKKRK
22125KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_40499.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021890886.14e-51agamous-like MADS-box protein AGL80
RefseqXP_021912474.15e-51agamous-like MADS-box protein AGL80
SwissprotQ9FJK33e-35AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLU5GF692e-47U5GF69_POPTR; Uncharacterized protein
STRINGevm.TU.contig_40499.22e-69(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-38M-type_MADS family protein
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]